An insecticidal toxin from Nephila clavata spider venom

Amino Acids
Lin JinShilong Yang

Abstract

Spiders are the most successful insect predators given that they use their venom containing insecticidal peptides as biochemical weapons for preying. Due to the high specificity and potency of peptidic toxins, discoveries of insecticidal toxins from spider venom have provided an opportunity to obtain natural compounds for agricultural applications without affecting human health. In this study, a novel insecticidal toxin (μ-NPTX-Nc1a) was identified and characterized from the venom of Nephila clavata. Its primary sequence is GCNPDCTGIQCGWPRCPGGQNPVMDKCVSCCPFCPPKSAQG which was determined by automated Edman degradation, cDNA cloning, and MS/MS analysis. BLAST search indicated that Nc1a shows no similarity with known peptides or proteins, indicating that Nc1a belongs to a novel family of insecticidal peptide. Nc1a displayed inhibitory effects on NaVand KVchannels in cockroach dorsal unpaired median neurons. The median lethal dose (LD50) of Nc1a on cockroach was 573 ng/g. Herein, a study that identifies a novel insecticidal toxin, which can be a potential candidate and/or template for the development of bioinsecticides, is presented.

References

Jan 1, 1995·Toxicon : Official Journal of the International Society on Toxinology·S G FigueiredoM Richardson
Apr 21, 2001·The Journal of Biological Chemistry·H W TedfordG F King
Nov 17, 2001·Toxicon : Official Journal of the International Society on Toxinology·Han-Seung JooChung-Soon Chang
Jan 16, 2007·Toxicon : Official Journal of the International Society on Toxinology·Graham M Nicholson
Jan 16, 2007·Toxicon : Official Journal of the International Society on Toxinology·Graham M Nicholson
Jul 16, 2008·The FEBS Journal·Simon J GunningGraham M Nicholson
Dec 30, 2010·Journal of Natural Products·Anne F BarslundKristian Strømgaard
May 4, 2011·Pest Management Science·Chris Bass, Linda M Field
May 19, 2012·Molecular & Cellular Proteomics : MCP·Shilong YangRen Lai
Jun 29, 2012·Toxins·Monique J WindleyGraham M Nicholson
Oct 2, 2012·Annual Review of Entomology·Glenn F King, Margaret C Hardy
Mar 26, 2013·Cellular and Molecular Life Sciences : CMLS·Jennifer J SmithPaul F Alewood
Oct 2, 2013·Proceedings of the National Academy of Sciences of the United States of America·Shilong YangGlenn F King
Jan 5, 2014·Antioxidants & Redox Signaling·Chad R Borges, Nisha D Sherma
Jan 15, 2015·Molecular Pharmacology·Laura-Nadine SchuhmacherEwan St John Smith
Jun 19, 2015·The Journal of Venomous Animals and Toxins Including Tropical Diseases·Herlinda ClementGerardo Corzo
Jul 30, 2015·Toxicon : Official Journal of the International Society on Toxinology·Leida Calegário de OliveiraMaria Elena De Lima
Sep 22, 2015·Toxins·Md Abdul HakimRen Lai

❮ Previous
Next ❯

Datasets Mentioned

BETA
ADF28500.1

Methods Mentioned

BETA
PCR

Software Mentioned

Clampfit10
SigmaPlot
tBlastP
FlexControl
FlexAnalysis
BioTools

Related Concepts

Trending Feeds

COVID-19

Coronaviruses encompass a large family of viruses that cause the common cold as well as more serious diseases, such as the ongoing outbreak of coronavirus disease 2019 (COVID-19; formally known as 2019-nCoV). Coronaviruses can spread from animals to humans; symptoms include fever, cough, shortness of breath, and breathing difficulties; in more severe cases, infection can lead to death. This feed covers recent research on COVID-19.

Blastomycosis

Blastomycosis fungal infections spread through inhaling Blastomyces dermatitidis spores. Discover the latest research on blastomycosis fungal infections here.

Nuclear Pore Complex in ALS/FTD

Alterations in nucleocytoplasmic transport, controlled by the nuclear pore complex, may be involved in the pathomechanism underlying multiple neurodegenerative diseases including Amyotrophic Lateral Sclerosis and Frontotemporal Dementia. Here is the latest research on the nuclear pore complex in ALS and FTD.

Applications of Molecular Barcoding

The concept of molecular barcoding is that each original DNA or RNA molecule is attached to a unique sequence barcode. Sequence reads having different barcodes represent different original molecules, while sequence reads having the same barcode are results of PCR duplication from one original molecule. Discover the latest research on molecular barcoding here.

Chronic Fatigue Syndrome

Chronic fatigue syndrome is a disease characterized by unexplained disabling fatigue; the pathology of which is incompletely understood. Discover the latest research on chronic fatigue syndrome here.

Evolution of Pluripotency

Pluripotency refers to the ability of a cell to develop into three primary germ cell layers of the embryo. This feed focuses on the mechanisms that underlie the evolution of pluripotency. Here is the latest research.

Position Effect Variegation

Position Effect Variagation occurs when a gene is inactivated due to its positioning near heterochromatic regions within a chromosome. Discover the latest research on Position Effect Variagation here.

STING Receptor Agonists

Stimulator of IFN genes (STING) are a group of transmembrane proteins that are involved in the induction of type I interferon that is important in the innate immune response. The stimulation of STING has been an active area of research in the treatment of cancer and infectious diseases. Here is the latest research on STING receptor agonists.

Microbicide

Microbicides are products that can be applied to vaginal or rectal mucosal surfaces with the goal of preventing, or at least significantly reducing, the transmission of sexually transmitted infections. Here is the latest research on microbicides.