Discovery of potent antimicrobial peptide analogs of Ixosin-B

Bioorganic & Medicinal Chemistry Letters
Feng-Di T LungYu-Shan Wu

Abstract

Antimicrobial peptides (AMPs) represent the first defense line against infection when organisms are infected by pathogens. These peptides are generally good targets for the development of antimicrobial agents. Peptide amide analogs of Ixosin-B, an antimicrobial peptide with amino acid sequence of QLKVDLWGTRSGIQPEQHSSGKSDVRRWRSRY, were designed, synthesized and examined for antimicrobial activities against Escherichia coli, Staphylococcus aureus, and Pseudomonas aeruginosa. Within the peptides synthesized, we discovered an 11-mer peptide, KRLRRVWRRWR-amide, which exhibited potent antimicrobial activity while very little hemolytic activity in human erythrocytes was observed even at high dose level (100 μM). With further modifications, this peptide could be developed into a potent antimicrobial agent in the future.

References

Jan 25, 2002·Nature·Michael Zasloff
Jan 30, 2002·FEMS Microbiology Letters·Robert E W Hancock, Annett Rozek
Nov 26, 2002·Planta·Bart P H J ThommaKarin Thevissen
Mar 17, 2004·Peptides·Jon-Paul S Powers, Robert E W Hancock
Jan 11, 2005·Protein and Peptide Letters·Sarah R DennisonDavid A Phoenix
May 15, 2008·BMC Structural Biology·Carolina Perez-Iratxeta, Miguel A Andrade-Navarro

❮ Previous
Next ❯

Citations

Nov 30, 2013·International Journal of Environmental Research and Public Health·Nerino AllocatiCarmine Di Ilio
Jan 21, 2017·Journal of Peptide Science : an Official Publication of the European Peptide Society·Siew Mei Samantha NgCheng San Brian Chia

❮ Previous
Next ❯

Related Concepts

Related Feeds

Antifungals

An antifungal, also known as an antimycotic medication, is a pharmaceutical fungicide or fungistatic used to treat and prevent mycosis such as athlete's foot, ringworm, candidiasis, cryptococcal meningitis, and others. Discover the latest research on antifungals here.

Antifungals (ASM)

An antifungal, also known as an antimycotic medication, is a pharmaceutical fungicide or fungistatic used to treat and prevent mycosis such as athlete's foot, ringworm, candidiasis, cryptococcal meningitis, and others. Discover the latest research on antifungals here.