First isolation and antinociceptive activity of a lipid transfer protein from noni (Morinda citrifolia) seeds

International Journal of Biological Macromolecules
Dyély C O CamposHermógenes D Oliveira

Abstract

In this study a novel heat-stable lipid transfer protein, designated McLTP1, was purified from noni (Morinda citrifolia L.) seeds, using four purification steps which resulted in a high-purified protein yield (72 mg McLTP1 from 100g of noni seeds). McLTP1 exhibited molecular masses of 9.450 and 9.466 kDa, determined by electrospray ionisation mass spectrometry. The N-terminal sequence of McLTP1 (AVPCGQVSSALSPCMSYLTGGGDDPEARCCAGV), as analysed by NCBI-BLAST database, revealed a high degree of identity with other reported plant lipid transfer proteins. In addition, this protein proved to be resistant to pepsin, trypsin and chymotrypsin digestion. McLTP1 given intraperitoneally (1, 2, 4 and 8 mg/kg) and orally (8 mg/kg) caused an inhibition of the writhing response induced by acetic acid in mice. This protein displayed thermostability, retaining 100% of its antinociceptive activity after 30 min incubation at 80 °C. Pretreatment of mice with McLTP1 (8 mg/kg, i.p. and p.o.) also decreased neurogenic and inflammatory phases of nociception in the formalin test. Naloxone (2 mg/kg, i.p.) antagonised the antinociceptive effect of McLTP1 suggesting that the opioid mechanisms mediate the analgesic properties of this protein.

References

Sep 1, 1992·Medicinal Research Reviews·A Barber, R Gottschlich
Feb 1, 1992·Plant Molecular Biology·S Torres-SchumannJ A Pintor-Toro
Sep 1, 1991·The Plant Cell·P SterkS C De Vries
Oct 5, 1990·Journal of Molecular Biology·S F AltschulD J Lipman
Sep 1, 1989·Pain·Manabu ShibataReizo Inoki
Feb 1, 1995·Trends in Microbiology·F García-OlmedoM Moreno
Aug 15, 2000·Plant Science : an International Journal of Experimental Plant Biology·V Arondel12J Kader
Apr 18, 2001·International Archives of Allergy and Immunology·R AseroR van Ree
Jun 1, 1996·Annual Review of Plant Physiology and Plant Molecular Biology·Jean-Claude Kader
Aug 13, 2004·American Journal of Hematology·Marcus E CarrMichael Bergeron
Mar 10, 2005·European Journal of Gastroenterology & Hepatology·Gunda MillonigWolfgang Vogel
Feb 9, 2007·Planta medica·Olivier Potterat, Matthias Hamburger
Apr 10, 2007·Peptides·André de Oliveira Carvalho, Valdirene Moreira Gomes
Dec 30, 2009·Journal of Ethnopharmacology·Nelson Fernando Quallio MarquesPaulo Roberto Dalsenter
Sep 8, 2011·Fundamental & Clinical Pharmacology·Alana de Freitas PiresCláudia Ferreira Santos
Nov 30, 2012·Biopolymers·Annia AlbaAnselmo J Otero-González
Nov 30, 2012·Biopolymers·Elisabeth F SchwartzMárcia R Mortari
Feb 20, 2014·Peptides·Elizabete de Souza CândidoOctávio Luiz Franco
Sep 28, 2014·Journal of Ethnopharmacology·D Priyamka Sreekeesoon, M Fawzi Mahomoodally

❮ Previous
Next ❯

Citations

Feb 22, 2018·Journal of Medicinal Food·Wilman CarrilloJoão Ernesto de Carvalho
Dec 6, 2019·Peptides·Richard J Bodnar
Mar 23, 2021·Peptides·Mariana Rocha Maximiano, Octávio Luiz Franco
May 16, 2020·International Journal of Biological Macromolecules·Luiz Francisco Wemmenson Gonçalves MouraMaria Izabel Florindo Guedes

❮ Previous
Next ❯

Related Concepts

Trending Feeds

COVID-19

Coronaviruses encompass a large family of viruses that cause the common cold as well as more serious diseases, such as the ongoing outbreak of coronavirus disease 2019 (COVID-19; formally known as 2019-nCoV). Coronaviruses can spread from animals to humans; symptoms include fever, cough, shortness of breath, and breathing difficulties; in more severe cases, infection can lead to death. This feed covers recent research on COVID-19.

Blastomycosis

Blastomycosis fungal infections spread through inhaling Blastomyces dermatitidis spores. Discover the latest research on blastomycosis fungal infections here.

Nuclear Pore Complex in ALS/FTD

Alterations in nucleocytoplasmic transport, controlled by the nuclear pore complex, may be involved in the pathomechanism underlying multiple neurodegenerative diseases including Amyotrophic Lateral Sclerosis and Frontotemporal Dementia. Here is the latest research on the nuclear pore complex in ALS and FTD.

Applications of Molecular Barcoding

The concept of molecular barcoding is that each original DNA or RNA molecule is attached to a unique sequence barcode. Sequence reads having different barcodes represent different original molecules, while sequence reads having the same barcode are results of PCR duplication from one original molecule. Discover the latest research on molecular barcoding here.

Chronic Fatigue Syndrome

Chronic fatigue syndrome is a disease characterized by unexplained disabling fatigue; the pathology of which is incompletely understood. Discover the latest research on chronic fatigue syndrome here.

Evolution of Pluripotency

Pluripotency refers to the ability of a cell to develop into three primary germ cell layers of the embryo. This feed focuses on the mechanisms that underlie the evolution of pluripotency. Here is the latest research.

Position Effect Variegation

Position Effect Variagation occurs when a gene is inactivated due to its positioning near heterochromatic regions within a chromosome. Discover the latest research on Position Effect Variagation here.

STING Receptor Agonists

Stimulator of IFN genes (STING) are a group of transmembrane proteins that are involved in the induction of type I interferon that is important in the innate immune response. The stimulation of STING has been an active area of research in the treatment of cancer and infectious diseases. Here is the latest research on STING receptor agonists.

Microbicide

Microbicides are products that can be applied to vaginal or rectal mucosal surfaces with the goal of preventing, or at least significantly reducing, the transmission of sexually transmitted infections. Here is the latest research on microbicides.

Related Papers

Journal of the Society for Integrative Oncology
Revista Española De Enfermedades Digestivas : Organo Oficial De La Sociedad Española De Patología Digestiva
J M López-Cepero AndradaA Amaya Vidal
Phytomedicine : International Journal of Phytotherapy and Phytopharmacology
C-J ZhengL-P Qin
Pharmacological Research : the Official Journal of the Italian Pharmacological Society
Fabrício Hoffmann Martins Do MonteGeanne Matos de Andrade Cunha
© 2022 Meta ULC. All rights reserved