PMID: 3747718Sep 15, 1986Paper

Guinea pig 33-amino acid gastrin

Life Sciences
C BonatoR S Yalow

Abstract

Only two 34 amino acid gastrin precursors have previously been purified and sequenced, those of pig and of human. The larger molecular form generally accounts for only about 5% of antral gastrin in most species. This report describes the purification of "big gastrin" from guinea pig (GP) antra. Two hundred grams of antra were defatted with acetone and the acetone cakes were extracted with 0.1M NH4HCO3. The extract was concentrated by adsorption onto and batch elution from QA-52 anion exchange cellulose. Fractionation on a mu Bondapak C18 cartridge resolved 3.6 nmol of the larger peptide from 61 nmol of immunoreactive gastrin in the original extract. Two additional HPLC steps brought the peptide to final purity. GP big gastrin is a 33 amino acid peptide with the following sequence: less than ELGPQVPAHLRTDLSKKQGPWAEEEAAYGWMDF# The GP peptide is different from pig G34 in 6 of the 17 NH2-terminal amino acids as well as in the previously reported deletion of a glutamic acid in the COOH-terminus.

References

Mar 15, 1978·Biochemical and Biophysical Research Communications·D N Podell, G N Abraham
Sep 1, 1978·Proceedings of the National Academy of Sciences of the United States of America·K Tatemoto, V Mutt
Apr 1, 1985·General and Comparative Endocrinology·B N Andersen
Dec 30, 1985·Life Sciences·C BonatoR S Yalow
Mar 1, 1973·Archives of Biochemistry and Biophysics·S SteinS Udenfriend
Feb 5, 1966·Nature·R A GregoryM I Grossman
Feb 5, 1966·Nature·P H BentleyR C Sheppard
Jan 1, 1981·Peptides·E StrausR S Yalow
Oct 1, 1982·Proceedings of the National Academy of Sciences of the United States of America·J EngR S Yalow
Jan 1, 1981·Peptides·K S HuiA Lajtha
Jan 1, 1981·Peptides·J R ReeveJ H Walsh

❮ Previous
Next ❯

Citations

Jan 1, 1990·Comparative Biochemistry and Physiology. B, Comparative Biochemistry·Y ShinomuraR S Yalow
Jan 1, 1990·Domestic Animal Endocrinology·D W Young, G B Smyth
Jan 1, 1994·Baillière's Clinical Endocrinology and Metabolism·R Dimaline, G J Dockray
May 14, 1998·Frontiers in Neuroendocrinology·A H Johnsen
Apr 20, 2010·Chembiochem : a European Journal of Chemical Biology·Ge-Min FangLei Liu
Jun 1, 1989·Equine Veterinary Journal. Supplement·G B SmythL S Hammond
Feb 27, 1987·Biochemical and Biophysical Research Communications·Y ShinomuraR S Yalow

❮ Previous
Next ❯

Related Concepts

Trending Feeds

COVID-19

Coronaviruses encompass a large family of viruses that cause the common cold as well as more serious diseases, such as the ongoing outbreak of coronavirus disease 2019 (COVID-19; formally known as 2019-nCoV). Coronaviruses can spread from animals to humans; symptoms include fever, cough, shortness of breath, and breathing difficulties; in more severe cases, infection can lead to death. This feed covers recent research on COVID-19.

Blastomycosis

Blastomycosis fungal infections spread through inhaling Blastomyces dermatitidis spores. Discover the latest research on blastomycosis fungal infections here.

Nuclear Pore Complex in ALS/FTD

Alterations in nucleocytoplasmic transport, controlled by the nuclear pore complex, may be involved in the pathomechanism underlying multiple neurodegenerative diseases including Amyotrophic Lateral Sclerosis and Frontotemporal Dementia. Here is the latest research on the nuclear pore complex in ALS and FTD.

Applications of Molecular Barcoding

The concept of molecular barcoding is that each original DNA or RNA molecule is attached to a unique sequence barcode. Sequence reads having different barcodes represent different original molecules, while sequence reads having the same barcode are results of PCR duplication from one original molecule. Discover the latest research on molecular barcoding here.

Chronic Fatigue Syndrome

Chronic fatigue syndrome is a disease characterized by unexplained disabling fatigue; the pathology of which is incompletely understood. Discover the latest research on chronic fatigue syndrome here.

Evolution of Pluripotency

Pluripotency refers to the ability of a cell to develop into three primary germ cell layers of the embryo. This feed focuses on the mechanisms that underlie the evolution of pluripotency. Here is the latest research.

Position Effect Variegation

Position Effect Variagation occurs when a gene is inactivated due to its positioning near heterochromatic regions within a chromosome. Discover the latest research on Position Effect Variagation here.

STING Receptor Agonists

Stimulator of IFN genes (STING) are a group of transmembrane proteins that are involved in the induction of type I interferon that is important in the innate immune response. The stimulation of STING has been an active area of research in the treatment of cancer and infectious diseases. Here is the latest research on STING receptor agonists.

Microbicide

Microbicides are products that can be applied to vaginal or rectal mucosal surfaces with the goal of preventing, or at least significantly reducing, the transmission of sexually transmitted infections. Here is the latest research on microbicides.