Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics.

Glycobiology
Dapeng ZhouWen Zhang

Abstract

Coronaviruses hijack human enzymes to assemble the sugar coat on their spike glycoproteins. The mechanisms by which human antibodies may recognize the antigenic viral peptide epitopes hidden by the sugar coat are unknown. Glycosylation by insect cells differs from the native form produced in human cells, but insect cell-derived influenza vaccines have been approved by the US Food and Drug Administration. In this study, we analyzed recombinant severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) spike protein secreted from BTI-Tn-5B1-4 insect cells, by trypsin and chymotrypsin digestion followed by mass spectrometry analysis. We acquired tandem mass spectrometry (MS/MS) spectrums for glycopeptides of all 22 predicted N-glycosylated sites. We further analyzed the surface accessibility of spike proteins according to cryogenic electron microscopy and homolog-modeled structures and available antibodies that bind to SARS-CoV-1. All 22 N-glycosylated sites of SARS-CoV-2 are modified by high-mannose N-glycans. MS/MS fragmentation clearly established the glycopeptide identities. Electron densities of glycans cover most of the spike receptor-binding domain of SARS-CoV-2, except YQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQ, similar to a reg...Continue Reading

References

Sep 4, 2004·The Journal of Biological Chemistry·Yanhui XuZihe Rao
Apr 9, 2005·The Journal of Immunology : Official Journal of the American Association of Immunologists·Yuxian HeShibo Jiang
Apr 7, 2006·The Journal of Biological Chemistry·Ponraj PrabakaranDimiter S Dimitrov
Sep 7, 2006·The Journal of Biological Chemistry·William C HwangRobert C Liddington
Jul 11, 2007·Proceedings of the National Academy of Sciences of the United States of America·Zhongyu ZhuDimiter S Dimitrov
May 28, 2013·Nature Structural & Molecular Biology·Leopold KongIan A Wilson
Mar 7, 2014·Proceedings of the National Academy of Sciences of the United States of America·Jincun ZhaoStanley Perlman

❮ Previous
Next ❯

Citations

Oct 24, 2020·Glycobiology·Luís Cláudio Nascimento da SilvaMaria Tereza Dos Santos Correia
Feb 2, 2021·ACS Biomaterials Science & Engineering·Jie WangJian Dong
Apr 20, 2021·Analytical Chemistry·Christoph GstöttnerElena Domínguez-Vega
Jun 6, 2021·Molecular & Cellular Proteomics : MCP·Jeremy L Praissman, Lance Wells
May 18, 2021·Frontiers in Immunology·Yuqing LiWeijie Dong
Jun 11, 2021·Frontiers in Molecular Biosciences·Sonia Beeckmans, Edilbert Van Driessche
Jul 23, 2021·International Journal of Nanomedicine·Wanru GuoMohamed S Draz
Jul 31, 2021·Journal of Proteome Research·Concepcion A RemorozaStephen E Stein
Dec 5, 2020·Analytical Chemistry·Tobias P WörnerAlbert J R Heck
Aug 28, 2021·Molecules : a Journal of Synthetic Chemistry and Natural Product Chemistry·William E Hackett, Joseph Zaia
Sep 24, 2021·Frontiers in Chemistry·Yong ZhangHao Yang

❮ Previous
Next ❯

Related Concepts

Trending Feeds

COVID-19

Coronaviruses encompass a large family of viruses that cause the common cold as well as more serious diseases, such as the ongoing outbreak of coronavirus disease 2019 (COVID-19; formally known as 2019-nCoV). Coronaviruses can spread from animals to humans; symptoms include fever, cough, shortness of breath, and breathing difficulties; in more severe cases, infection can lead to death. This feed covers recent research on COVID-19.

Blastomycosis

Blastomycosis fungal infections spread through inhaling Blastomyces dermatitidis spores. Discover the latest research on blastomycosis fungal infections here.

Nuclear Pore Complex in ALS/FTD

Alterations in nucleocytoplasmic transport, controlled by the nuclear pore complex, may be involved in the pathomechanism underlying multiple neurodegenerative diseases including Amyotrophic Lateral Sclerosis and Frontotemporal Dementia. Here is the latest research on the nuclear pore complex in ALS and FTD.

Applications of Molecular Barcoding

The concept of molecular barcoding is that each original DNA or RNA molecule is attached to a unique sequence barcode. Sequence reads having different barcodes represent different original molecules, while sequence reads having the same barcode are results of PCR duplication from one original molecule. Discover the latest research on molecular barcoding here.

Chronic Fatigue Syndrome

Chronic fatigue syndrome is a disease characterized by unexplained disabling fatigue; the pathology of which is incompletely understood. Discover the latest research on chronic fatigue syndrome here.

Evolution of Pluripotency

Pluripotency refers to the ability of a cell to develop into three primary germ cell layers of the embryo. This feed focuses on the mechanisms that underlie the evolution of pluripotency. Here is the latest research.

Position Effect Variegation

Position Effect Variagation occurs when a gene is inactivated due to its positioning near heterochromatic regions within a chromosome. Discover the latest research on Position Effect Variagation here.

STING Receptor Agonists

Stimulator of IFN genes (STING) are a group of transmembrane proteins that are involved in the induction of type I interferon that is important in the innate immune response. The stimulation of STING has been an active area of research in the treatment of cancer and infectious diseases. Here is the latest research on STING receptor agonists.

Microbicide

Microbicides are products that can be applied to vaginal or rectal mucosal surfaces with the goal of preventing, or at least significantly reducing, the transmission of sexually transmitted infections. Here is the latest research on microbicides.