Modulation by LL-37 of the responses of salivary glands to purinergic agonists

Molecular Pharmacology
Stéphanie PochetJean-Paul Dehaye

Abstract

The interaction of mice submandibular gland cells with LL-37 ([LL-37, 37 aa]), a cationic peptide with immunomodulatory properties, was investigated. LL-37 at a concentration that did not affect the integrity of the cells increased the uptake of calcium and activated a calcium-insensitive phospholipase A(2) (PLA(2)). The small release of ATP induced by LL-37 could not account for this stimulation because apyrase did not significantly block the response to LL-37. The divalent cation magnesium inhibited the response to LL-37, but this inhibition was probably nonspecific because it also inhibited the in vitro bacteriostatic effect of the peptide. The increase of calcium uptake by LL-37 was not affected by 1-[N,O-bis(5-isoquinolinesulfonyl)-N-methyl-L-tyrosyl]-4-phenylpiperazine (KN-62), a rather specific inhibitor of P2X(7) receptors in mice. LL-37 also increased [Ca(2+)](i) in cells from mice invalidated for these receptors. LL-37 had no effect on the response to carbachol. It inhibited the increase of [Ca(2+)](i) and the activation of phospholipase D by ATP. It potentiated the activation of the PLA(2) by the nucleotide. Finally, LL-37 increased the fluidity of the plasma membrane of submandibular gland cel...Continue Reading

References

Jan 3, 1995·Proceedings of the National Academy of Sciences of the United States of America·B AgerberthG H Gudmundsson
Nov 19, 1997·Neuropharmacology·C VirginioA Surprenant
Jul 2, 1998·Biochemical and Biophysical Research Communications·B AmmarM Roch-Arveiller
Sep 11, 1999·Toxicon : Official Journal of the International Society on Toxinology·S S SainiJ W Peterson
Oct 4, 2000·The Journal of Biological Chemistry·M SolleC A Gabel
Mar 9, 2002·The Journal of Immunology : Official Journal of the American Association of Immunologists·David G PerregauxChristopher A Gabel
Sep 25, 2002·Physiological Reviews·R Alan North
Oct 29, 2002·Cellular Signalling·Stéphanie PochetJean-Paul Dehaye
Nov 28, 2002·Journal of Dental Research·M MurakamiR L Gallo
Feb 13, 2003·Archives of Otolaryngology--head & Neck Surgery·Jeong-Su WooHeung-Man Lee
Feb 27, 2003·Antimicrobial Agents and Chemotherapy·Hongxia Zhao, Paavo K J Kinnunen
Mar 5, 2003·Pharmacological Reviews·Michael R Yeaman, Nannette Y Yount
Mar 11, 2003·The Journal of Immunology : Official Journal of the American Association of Immunologists·François Van LaethemOberdan Leo
Jun 6, 2003·Cellular and Molecular Life Sciences : CMLS·R Bals, J M Wilson
Dec 10, 2003·The Journal of Immunology : Official Journal of the American Association of Immunologists·G Sandra TjabringaPieter S Hiemstra
Apr 7, 2004·The Journal of Immunology : Official Journal of the American Association of Immunologists·Andreas ElssnerMark D Wewers
May 22, 2004·Caries Research·A Van Nieuw AmerongenE C I Veerman
Jun 12, 2004·Proceedings of the National Academy of Sciences of the United States of America·Cristina AndreiAnna Rubartelli
Jun 15, 2004·International Journal of Antimicrobial Agents·Karen H BartlettPeter S Thorne
Apr 28, 2005·Antimicrobial Agents and Chemotherapy·Dawn M E BowdishRobert E W Hancock
May 10, 2005·The Journal of Immunology : Official Journal of the American Association of Immunologists·Kahori KurosakaDe Yang
Sep 24, 2005·The Journal of Immunology : Official Journal of the American Association of Immunologists·Sho TokumaruKoji Hashimoto
Dec 13, 2005·American Journal of Respiratory Cell and Molecular Biology·Y Elaine LauDonald J Davidson

❮ Previous
Next ❯

Citations

Jan 6, 2010·Archivum Immunologiae Et Therapiae Experimentalis·Robert BuckiWojciech Sokołowski
Mar 28, 2008·Purinergic Signalling·I Novak
Nov 26, 2009·Natural Product Reports·Matthew F Burton, Patrick G Steel
Jan 1, 2014·Journal of Clinical Periodontology·Anupong MakeudomSuttichai Krisanaprakornkit
Nov 12, 2015·Biochimica Et Biophysica Acta·Daniela XhindoliAlessandro Tossi
Mar 17, 2009·Biochimica Et Biophysica Acta·Christian CodePaavo K J Kinnunen
Jun 12, 2013·Biochemical and Biophysical Research Communications·Ajay K Mahalka, Paavo K J Kinnunen
Jun 13, 2015·BioMed Research International·Chien-Jung ChenMargaret Dah-Tsyr Chang
Nov 17, 2009·Biochimica Et Biophysica Acta·Michèle SeilJean-Paul Dehaye
Oct 25, 2016·Peptides·Eddy-Tim VerjansLiliane Schoofs
Jul 4, 2006·Cellular Signalling·Mikel Garcia-MarcosJean-Paul Dehaye

❮ Previous
Next ❯

Related Concepts

Trending Feeds

COVID-19

Coronaviruses encompass a large family of viruses that cause the common cold as well as more serious diseases, such as the ongoing outbreak of coronavirus disease 2019 (COVID-19; formally known as 2019-nCoV). Coronaviruses can spread from animals to humans; symptoms include fever, cough, shortness of breath, and breathing difficulties; in more severe cases, infection can lead to death. This feed covers recent research on COVID-19.

Blastomycosis

Blastomycosis fungal infections spread through inhaling Blastomyces dermatitidis spores. Discover the latest research on blastomycosis fungal infections here.

Nuclear Pore Complex in ALS/FTD

Alterations in nucleocytoplasmic transport, controlled by the nuclear pore complex, may be involved in the pathomechanism underlying multiple neurodegenerative diseases including Amyotrophic Lateral Sclerosis and Frontotemporal Dementia. Here is the latest research on the nuclear pore complex in ALS and FTD.

Applications of Molecular Barcoding

The concept of molecular barcoding is that each original DNA or RNA molecule is attached to a unique sequence barcode. Sequence reads having different barcodes represent different original molecules, while sequence reads having the same barcode are results of PCR duplication from one original molecule. Discover the latest research on molecular barcoding here.

Chronic Fatigue Syndrome

Chronic fatigue syndrome is a disease characterized by unexplained disabling fatigue; the pathology of which is incompletely understood. Discover the latest research on chronic fatigue syndrome here.

Evolution of Pluripotency

Pluripotency refers to the ability of a cell to develop into three primary germ cell layers of the embryo. This feed focuses on the mechanisms that underlie the evolution of pluripotency. Here is the latest research.

Position Effect Variegation

Position Effect Variagation occurs when a gene is inactivated due to its positioning near heterochromatic regions within a chromosome. Discover the latest research on Position Effect Variagation here.

STING Receptor Agonists

Stimulator of IFN genes (STING) are a group of transmembrane proteins that are involved in the induction of type I interferon that is important in the innate immune response. The stimulation of STING has been an active area of research in the treatment of cancer and infectious diseases. Here is the latest research on STING receptor agonists.

Microbicide

Microbicides are products that can be applied to vaginal or rectal mucosal surfaces with the goal of preventing, or at least significantly reducing, the transmission of sexually transmitted infections. Here is the latest research on microbicides.