PMID: 3763441Jul 1, 1986Paper

Sequences of gastrins purified from a single antrum of dog and of goat

Peptides
C BonatoR S Yalow

Abstract

Heptadecapeptide gastrins (G17) have been purified and sequenced from a variety of species. However, progastrin (G34) sequences have been determined only for pig and human from purified peptides and for rat from cDNA. Since G34 in most species accounts for only approximately 5% of total antral gastrin, micropurification techniques must be employed to avoid the need for large quantities of antral tissue. Efficient purification methodology yielded 1.5 and 1.3 nmol of G34 from the antrum of a single goat and of a single dog, respectively. The N-terminal pyroglutamyl residues were enzymatically removed and the peptides were sequenced through to the proximity of their COOH-termini. The COOH-terminal sequences of goat and dog G34 were confirmed by sequencing the corresponding deblocked G17 from each animal. The previously published dog G17 sequence was shown to be incorrect. The sequences for dog and goat G34 are: Dog less than ELGLQGPPQLVADLSKKQGPWMEEEEAAYGWMDF# Goat less than ELGLQDPPHMVADLSKKQGPWVEEEEAAYGWMDF# Dog and goat gastrins differ in 3 sites in the 17 amino acid NH2-terminus and only a single site in G17 (the sites of differences are underlined). The ratio for sulfated to non-sulfated antral G17 is 9:1 for the goat and 1:9...Continue Reading

References

Sep 1, 1978·Proceedings of the National Academy of Sciences of the United States of America·K Tatemoto, V Mutt
Apr 1, 1985·General and Comparative Endocrinology·B N Andersen
Dec 30, 1985·Life Sciences·C BonatoR S Yalow
Mar 1, 1973·Archives of Biochemistry and Biophysics·S SteinS Udenfriend
Aug 10, 1968·Nature·K L AgarwalH J Tracy
May 21, 1969·Journal of the American Chemical Society·K L AgarwalR C Sheppard
Apr 15, 1969·Experientia·K L AgarwalR C Sheppard
Feb 5, 1966·Nature·R A GregoryM I Grossman
Jan 1, 1981·Peptides·E StrausR S Yalow
May 1, 1983·Proceedings of the National Academy of Sciences of the United States of America·E BoelK A Marcker
Feb 1, 1982·Proceedings of the National Academy of Sciences of the United States of America·O J YooK L Agarwal
Oct 1, 1982·Proceedings of the National Academy of Sciences of the United States of America·J EngR S Yalow
Jan 1, 1981·Peptides·J R ReeveJ H Walsh

❮ Previous
Next ❯

Citations

Jan 2, 1992·Regulatory Peptides·J EngE Straus
Jul 1, 1988·Peptides·R JiangJ R Reeve
Jan 1, 1990·Comparative Biochemistry and Physiology. B, Comparative Biochemistry·Y ShinomuraR S Yalow
Jun 1, 1987·Brain Research Bulletin·Z W FanR S Yalow
Jan 1, 1990·Domestic Animal Endocrinology·D W Young, G B Smyth
Jan 1, 1994·Baillière's Clinical Endocrinology and Metabolism·R Dimaline, G J Dockray
Feb 27, 1987·Biochemical and Biophysical Research Communications·Y ShinomuraR S Yalow
May 14, 1998·Frontiers in Neuroendocrinology·A H Johnsen

❮ Previous
Next ❯

Related Concepts

Trending Feeds

COVID-19

Coronaviruses encompass a large family of viruses that cause the common cold as well as more serious diseases, such as the ongoing outbreak of coronavirus disease 2019 (COVID-19; formally known as 2019-nCoV). Coronaviruses can spread from animals to humans; symptoms include fever, cough, shortness of breath, and breathing difficulties; in more severe cases, infection can lead to death. This feed covers recent research on COVID-19.

Blastomycosis

Blastomycosis fungal infections spread through inhaling Blastomyces dermatitidis spores. Discover the latest research on blastomycosis fungal infections here.

Nuclear Pore Complex in ALS/FTD

Alterations in nucleocytoplasmic transport, controlled by the nuclear pore complex, may be involved in the pathomechanism underlying multiple neurodegenerative diseases including Amyotrophic Lateral Sclerosis and Frontotemporal Dementia. Here is the latest research on the nuclear pore complex in ALS and FTD.

Applications of Molecular Barcoding

The concept of molecular barcoding is that each original DNA or RNA molecule is attached to a unique sequence barcode. Sequence reads having different barcodes represent different original molecules, while sequence reads having the same barcode are results of PCR duplication from one original molecule. Discover the latest research on molecular barcoding here.

Chronic Fatigue Syndrome

Chronic fatigue syndrome is a disease characterized by unexplained disabling fatigue; the pathology of which is incompletely understood. Discover the latest research on chronic fatigue syndrome here.

Evolution of Pluripotency

Pluripotency refers to the ability of a cell to develop into three primary germ cell layers of the embryo. This feed focuses on the mechanisms that underlie the evolution of pluripotency. Here is the latest research.

Position Effect Variegation

Position Effect Variagation occurs when a gene is inactivated due to its positioning near heterochromatic regions within a chromosome. Discover the latest research on Position Effect Variagation here.

STING Receptor Agonists

Stimulator of IFN genes (STING) are a group of transmembrane proteins that are involved in the induction of type I interferon that is important in the innate immune response. The stimulation of STING has been an active area of research in the treatment of cancer and infectious diseases. Here is the latest research on STING receptor agonists.

Microbicide

Microbicides are products that can be applied to vaginal or rectal mucosal surfaces with the goal of preventing, or at least significantly reducing, the transmission of sexually transmitted infections. Here is the latest research on microbicides.

Related Papers

Biochemical and Biophysical Research Communications
Y ShinomuraR S Yalow
© 2021 Meta ULC. All rights reserved