SNX-325, a novel calcium antagonist from the spider Segestria florentina

Biochemistry
R NewcombL Nadasdi

Abstract

A novel selective calcium channel antagonist peptide, SNX-325, has been isolated from the venom of the spider Segestria florentina. The peptide was isolated using as bioassays the displacement of radioiodinated omega-conopeptide SNX-230 (MVIIC) from rat brain synaptosomal membranes, as well as the inhibition of the barium current through cloned expressed calcium channels in oocytes. The primary sequence of SNX-325 is GSCIESGKSCTHSRSMKNGLCCPKSRCNCRQIQHRHDYLGKRKYSCRCS, which is a novel amino acid sequence. Solid-phase synthesis resulted in a peptide that is chromatographically identical with the native peptide and which has the same configuration of cysteine residues as the spider venom peptide omega-Aga-IVa [Mintz, I. M., et al., (1992) Nature 355, 827-829]. At micromolar concentrations, SNX-325 is an inhibitor of most calcium, but not sodium or potassium, currents. At nanomolar concentrations, SNX-325 is a selective blocker of the cloned expressed class B (N-type), but not class C (cardiac L), A, or E, calcium channels. SNX-325 is approximately equipotent with the N-channel selective omega-conopeptides (GVIA and MVIIA as well as closely related synthetic derivatives) in blocking the potassium induced release of tritiated norepi...Continue Reading

References

Oct 20, 1992·Biochemistry·C A RamiloB M Olivera
Jan 1, 1992·Methods in Enzymology·A L Goldin
Jan 1, 1991·Toxicon : Official Journal of the International Society on Toxinology·G B QuistadE W Fu
Jan 1, 1990·Annual Review of Neuroscience·P Hess
Jan 2, 1987·Science·R J Miller
Oct 1, 1988·Trends in Neurosciences·R W TsienA P Fox
Apr 1, 1989·Journal of Cerebral Blood Flow and Metabolism : Official Journal of the International Society of Cerebral Blood Flow and Metabolism·B K Siesjö, F Bengtsson
Nov 1, 1983·Proceedings of the National Academy of Sciences of the United States of America·G E TarrM J Coon
Jan 1, 1995·Annual Review of Pharmacology and Toxicology·G P Miljanich, J Ramachandran
Jan 1, 1994·Annual Review of Biochemistry·B M OliveraM E Adams
Aug 15, 1993·Proceedings of the National Academy of Sciences of the United States of America·K ValentinoR Ciaranello
Jan 1, 1993·Toxicon : Official Journal of the International Society on Toxinology·M do N CordeiroM Richardson

❮ Previous
Next ❯

Citations

Apr 7, 2004·Toxicon : Official Journal of the International Society on Toxinology·Lucia Kuhn-NentwigWolfgang Nentwig
Nov 2, 2001·Toxicon : Official Journal of the International Society on Toxinology·A LipkinE Grishin
Nov 17, 2001·Toxicon : Official Journal of the International Society on Toxinology·Lachlan D Rash, Wayne C Hodgson
Oct 29, 1998·Toxicon : Official Journal of the International Society on Toxinology·R S Norton, P K Pallaghy
Nov 22, 2000·Biochimie·P EscoubasG Corzo
Sep 22, 1999·European Journal of Biochemistry·E Grishin
Feb 1, 2007·Neuropsychiatric Disease and Treatment·Joseph G McGivern
Feb 6, 2013·Toxins·Silmara R SousaRichard J Lewis
Jun 1, 2007·Expert Opinion on Drug Discovery·Pierre Escoubas, Frank Bosmans
Sep 25, 2007·Toxicon : Official Journal of the International Society on Toxinology·Kirill PluzhnikovEugene Grishin
Jun 11, 2004·European Journal of Pharmacology·Renê de O BeleboniWagner F Dos Santos
Sep 20, 2005·Toxicon : Official Journal of the International Society on Toxinology·Sergey Kozlov, Eugene Grishin
Jan 2, 2007·Toxicon : Official Journal of the International Society on Toxinology·Glenn F King
Feb 3, 2007·Natural Product Reports·Georgina EstradaGerardo Corzo
Oct 26, 2016·Neuropharmacology·Emmanuel Bourinet, Gerald W Zamponi

❮ Previous
Next ❯

Related Concepts

Trending Feeds

COVID-19

Coronaviruses encompass a large family of viruses that cause the common cold as well as more serious diseases, such as the ongoing outbreak of coronavirus disease 2019 (COVID-19; formally known as 2019-nCoV). Coronaviruses can spread from animals to humans; symptoms include fever, cough, shortness of breath, and breathing difficulties; in more severe cases, infection can lead to death. This feed covers recent research on COVID-19.

Blastomycosis

Blastomycosis fungal infections spread through inhaling Blastomyces dermatitidis spores. Discover the latest research on blastomycosis fungal infections here.

Nuclear Pore Complex in ALS/FTD

Alterations in nucleocytoplasmic transport, controlled by the nuclear pore complex, may be involved in the pathomechanism underlying multiple neurodegenerative diseases including Amyotrophic Lateral Sclerosis and Frontotemporal Dementia. Here is the latest research on the nuclear pore complex in ALS and FTD.

Applications of Molecular Barcoding

The concept of molecular barcoding is that each original DNA or RNA molecule is attached to a unique sequence barcode. Sequence reads having different barcodes represent different original molecules, while sequence reads having the same barcode are results of PCR duplication from one original molecule. Discover the latest research on molecular barcoding here.

Chronic Fatigue Syndrome

Chronic fatigue syndrome is a disease characterized by unexplained disabling fatigue; the pathology of which is incompletely understood. Discover the latest research on chronic fatigue syndrome here.

Evolution of Pluripotency

Pluripotency refers to the ability of a cell to develop into three primary germ cell layers of the embryo. This feed focuses on the mechanisms that underlie the evolution of pluripotency. Here is the latest research.

Position Effect Variegation

Position Effect Variagation occurs when a gene is inactivated due to its positioning near heterochromatic regions within a chromosome. Discover the latest research on Position Effect Variagation here.

STING Receptor Agonists

Stimulator of IFN genes (STING) are a group of transmembrane proteins that are involved in the induction of type I interferon that is important in the innate immune response. The stimulation of STING has been an active area of research in the treatment of cancer and infectious diseases. Here is the latest research on STING receptor agonists.

Microbicide

Microbicides are products that can be applied to vaginal or rectal mucosal surfaces with the goal of preventing, or at least significantly reducing, the transmission of sexually transmitted infections. Here is the latest research on microbicides.